FYN (NM_002037) Human Mass Spec Standard
CAT#: PH324691
FYN MS Standard C13 and N15-labeled recombinant protein (NP_002028)
View other "FYN" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FYN MS Standard C13 and N15-labeled recombinant protein (NP_002028) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224691 |
| Predicted MW | 60.6 kDa |
| Protein Sequence |
>RC224691 representing NM_002037
Red=Cloning site Green=Tags(s) MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN GGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNG QFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSL LDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD CPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002028 |
| RefSeq Size | 2650 |
| RefSeq ORF | 1611 |
| Synonyms | p59-FYN; SLK; SYN |
| Locus ID | 2534 |
| Cytogenetics | 6q21 |
| Summary | This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400745 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC403505 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC407122 | FYN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400745 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1 |
CNY 4840.00 |
|
| LY403505 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2 |
CNY 4840.00 |
|
| LY407122 | Transient overexpression lysate of FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3 |
CNY 3080.00 |
|
| PH307620 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_694593) |
CNY 19520.00 |
|
| PH319374 | FYN MS Standard C13 and N15-labeled recombinant protein (NP_694592) |
CNY 19520.00 |
|
| TP307620 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP319374 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP324691 | Recombinant protein of human FYN oncogene related to SRC, FGR, YES (FYN), transcript variant 1, 20 µg |
CNY 2900.00 |


