TMEM80 (NM_001042463) Human Mass Spec Standard
CAT#: PH324685
TMEM80 MS Standard C13 and N15-labeled recombinant protein (NP_001035928)
View other "TMEM80" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | TMEM80 MS Standard C13 and N15-labeled recombinant protein (NP_001035928) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224685 |
| Predicted MW | 18 kDa |
| Protein Sequence |
>RC224685 representing NM_001042463
Red=Cloning site Green=Tags(s) MAEGARARGPRGCRDRDGPAGGAGKMAAPRRGRGSSTVLSSVPLQMLFYLSGTYYALYFLATLLMITYKS QVFSYPHRYLVLDLALLFLMGILEAVRLYLGTRGNLTEAERPLAASLALTAGTALLSAHFLLWQALVLWA DWALSATLLALHGLEAVLQVVAIAAFTR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035928 |
| RefSeq Size | 1637 |
| RefSeq ORF | 504 |
| Locus ID | 283232 |
| Cytogenetics | 11p15.5 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406341 | TMEM80 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406341 | Transient overexpression lysate of transmembrane protein 80 (TMEM80), transcript variant 1 |
CNY 3080.00 |
|
| PH302288 | TMEM80 MS Standard C13 and N15-labeled recombinant protein (NP_777600) |
CNY 19520.00 |
|
| TP302288 | Recombinant protein of human transmembrane protein 80 (TMEM80), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324685 | Purified recombinant protein of Homo sapiens transmembrane protein 80 (TMEM80), transcript variant 2, 20 µg |
CNY 2900.00 |
