Clathrin light chain (CLTB) (NM_007097) Human Mass Spec Standard
CAT#: PH324622
CLTB MS Standard C13 and N15-labeled recombinant protein (NP_009028)
View other "Clathrin light chain" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CLTB MS Standard C13 and N15-labeled recombinant protein (NP_009028) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224622 |
| Predicted MW | 25 kDa |
| Protein Sequence |
>RC224622 representing NM_007097
Red=Cloning site Green=Tags(s) MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN QRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK DVSRLRSVLMSLKQTPLSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009028 |
| RefSeq Size | 1184 |
| RefSeq ORF | 687 |
| Synonyms | LCB |
| Locus ID | 1212 |
| Cytogenetics | 5q35.2 |
| Summary | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Endocytosis, Huntington's disease, Lysosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400697 | CLTB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416210 | CLTB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400697 | Transient overexpression lysate of clathrin, light chain (Lcb) (CLTB), transcript variant 1 |
CNY 3080.00 |
|
| LY416210 | Transient overexpression lysate of clathrin, light chain (Lcb) (CLTB), transcript variant 2 |
CNY 3080.00 |
|
| TP324622 | Recombinant protein of human clathrin, light chain (Lcb) (CLTB), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Clathrin light chain产品


