ALKBH6 (NM_032878) Human Mass Spec Standard
CAT#: PH324553
ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_116267)
View other "ALKBH6" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_116267) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224553 |
Predicted MW | 29.1 kDa |
Protein Sequence |
>RC224553 representing NM_032878
Red=Cloning site Green=Tags(s) MAGRGMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQV FNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIM PHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLH GIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116267 |
RefSeq Size | 980 |
RefSeq ORF | 798 |
Synonyms | ABH6 |
Locus ID | 84964 |
Cytogenetics | 19q13.12 |
Summary | Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404763 | ALKBH6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409909 | ALKBH6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404763 | Transient overexpression lysate of alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 1 |
CNY 3080.00 |
|
LY409909 | Transient overexpression lysate of alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 2 |
CNY 3080.00 |
|
PH321937 | ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_942567) |
CNY 19520.00 |
|
TP321937 | Recombinant protein of human alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP324553 | Recombinant protein of human alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 2, 20 µg |
CNY 2900.00 |