CSEN (KCNIP3) (NM_001034914) Human Mass Spec Standard
CAT#: PH324492
KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001030086)
View other "CSEN" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001030086) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224492 |
| Predicted MW | 26.2 kDa |
| Protein Sequence |
>RC224492 representing NM_001034914
Red=Cloning site Green=Tags(s) MGIQGMELCAMAVVVLLFIAVLKQFGILEPISMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSL YRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEK LKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFL EACQKDENIMSSMQLFENVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001030086 |
| RefSeq Size | 2735 |
| RefSeq ORF | 690 |
| Synonyms | CSEN; DREAM; KCHIP3 |
| Locus ID | 30818 |
| Cytogenetics | 2q11.1 |
| Summary | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415545 | KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422112 | KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415545 | Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1 |
CNY 3080.00 |
|
| LY422112 | Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2 |
CNY 3080.00 |
|
| PH303957 | KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_038462) |
CNY 19520.00 |
|
| TP303957 | Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324492 | Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2, 20 µg |
CNY 2900.00 |
