SOX21 (NM_007084) Human Mass Spec Standard
CAT#: PH324471
SOX21 MS Standard C13 and N15-labeled recombinant protein (NP_009015)
View other "SOX21" proteins (2)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SOX21 MS Standard C13 and N15-labeled recombinant protein (NP_009015) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224471 |
Predicted MW | 28.4 kDa |
Protein Sequence |
>RC224471 representing NM_007084
Red=Cloning site Green=Tags(s) MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAA AAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAA AAAAAAAAAGGHTHSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009015 |
RefSeq Size | 2537 |
RefSeq ORF | 828 |
Synonyms | SOX25 |
Locus ID | 11166 |
Cytogenetics | 13q32.1 |
Summary | SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM, Apr 2004] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP324471 | Recombinant protein of human SRY (sex determining region Y)-box 21 (SOX21), 20 µg |
CNY 2900.00 |
|
TP762001 | Purified recombinant protein of Human SRY (sex determining region Y)-box 21 (SOX21),Met1-Ala140, with N-terminal His-Trx tag, expressed in E. coli, 50ug |
CNY 2050.00 |