ATP1B4 (NM_012069) Human Mass Spec Standard
CAT#: PH324408
ATP1B4 MS Standard C13 and N15-labeled recombinant protein (NP_036201)
View other "ATP1B4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ATP1B4 MS Standard C13 and N15-labeled recombinant protein (NP_036201) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224408 |
| Predicted MW | 40.9 kDa |
| Protein Sequence |
>RC224408 representing NM_012069
Red=Cloning site Green=Tags(s) MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEKEE EEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGLILLIYFFFYASLAAVITLCMYTLFLTISPYIPT FTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNED EDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISY YPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLN IET myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036201 |
| RefSeq Size | 3857 |
| RefSeq ORF | 1059 |
| Locus ID | 23439 |
| Cytogenetics | Xq24 |
| Summary | This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
| Protein Families | Transmembrane |
| Protein Pathways | Cardiac muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415995 | ATP1B4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415995 | Transient overexpression lysate of ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2 |
CNY 3080.00 |
|
| TP324408 | Recombinant protein of human ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2, 20 µg |
CNY 2900.00 |
