GIPC (GIPC1) (NM_202468) Human Mass Spec Standard
CAT#: PH324373
GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974197)
View other "GIPC" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974197) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224373 |
Predicted MW | 36 kDa |
Protein Sequence |
>RC224373 protein sequence
Red=Cloning site Green=Tags(s) MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_974197 |
RefSeq Size | 1908 |
RefSeq ORF | 999 |
Synonyms | C19orf3; GIPC; GLUT1CBP; Hs.6454; IIP-1; NIP; OPDM2; RGS19IP1; SEMCAP; SYNECTIIN; SYNECTIN; TIP-2 |
Locus ID | 10755 |
Cytogenetics | 19p13.12 |
Summary | GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM, Apr 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404361 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404363 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417114 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404361 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3 |
CNY 3080.00 |
|
LY404363 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 5 |
CNY 3080.00 |
|
LY417114 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 1 |
CNY 3080.00 |
|
PH301175 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974199) |
CNY 19520.00 |
|
PH316466 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_005707) |
CNY 19520.00 |
|
TP301175 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 5, 20 µg |
CNY 2900.00 |
|
TP316466 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP324373 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3, 20 µg |
CNY 2900.00 |