PRRG2 (NM_000951) Human Mass Spec Standard
CAT#: PH324364
PRRG2 MS Standard C13 and N15-labeled recombinant protein (NP_000942)
View other "PRRG2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PRRG2 MS Standard C13 and N15-labeled recombinant protein (NP_000942) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224364 |
Predicted MW | 22.2 kDa |
Protein Sequence |
>RC224364 representing NM_000951
Red=Cloning site Green=Tags(s) MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTPGNLERECLEE RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILLIVLAGLGAFWYLRWRQHRGQ QPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQALAASGVHDAPPPPYTSLRRPH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000942 |
RefSeq Size | 1167 |
RefSeq ORF | 606 |
Synonyms | PRGP2 |
Locus ID | 5639 |
Cytogenetics | 19q13.33 |
Summary | The protein encoded by this gene is a single-pass transmembrane protein containing an N-terminal gamma-carboxyglutamic acid (Gla) domain and tandem Pro/Leu-Pro-Xaa-Tyr (PY) motifs at its C-terminal end. The Gla domain is exposed on the cell surface while the PY motifs are cytoplasmic. The PY motifs of the encoded protein have been shown to interact with YAP1, a WW domain-containing protein. Therefore, it is thought that the encoded protein may be part of a signal transduction pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424446 | PRRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424446 | Transient overexpression lysate of proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2) |
CNY 3080.00 |
|
TP324364 | Recombinant protein of human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), 20 µg |
CNY 2900.00 |
|
TP761765 | Purified recombinant protein of Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |