UBXD5 (UBXN11) (NM_001077262) Human Mass Spec Standard
CAT#: PH324331
UBXN11 MS Standard C13 and N15-labeled recombinant protein (NP_001070730)
View other "UBXD5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | UBXN11 MS Standard C13 and N15-labeled recombinant protein (NP_001070730) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224331 |
Predicted MW | 43.1 kDa |
Protein Sequence |
>RC224331 representing NM_001077262
Red=Cloning site Green=Tags(s) MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQGDSL APPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRC LRDILDGFFPSELQRLYPNGVPFKVSDLRNQVYLEDGLDPFPGEGRVVGRQLMHKALDRVEEHPGSRMTA EKFLNRLPKFVIRQGEVIDIRGPIRDTLQNCCPLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLR IKSENGEQAFLLMMQPDNTIGDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLR ARRAPKSSLKFSPGPCPGPGPGPSPGPGPGPSPGPGPGPSPCPGPSPSPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001070730 |
RefSeq Size | 1384 |
RefSeq ORF | 1200 |
Synonyms | COA-1; PP2243; SOC; SOCI; UBXD5 |
Locus ID | 91544 |
Cytogenetics | 1p36.11 |
Summary | This gene encodes a protein with a divergent C-terminal UBX domain. The homologous protein in the rat interacts with members of the Rnd subfamily of Rho GTPases at the cell periphery through its C-terminal region. It also interacts with several heterotrimeric G proteins through their G-alpha subunits and promotes Rho GTPase activation. It is proposed to serve a bidirectional role in the promotion and inhibition of Rho activity through upstream signaling pathways. The 3' coding sequence of this gene contains a polymoprhic region of 24 nt tandem repeats. Several transcripts containing between 1.5 and five repeat units have been reported. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421394 | UBXN11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421394 | Transient overexpression lysate of UBX domain protein 11 (UBXN11), transcript variant 3 |
CNY 3080.00 |
|
TP324331 | Purified recombinant protein of Homo sapiens UBX domain protein 11 (UBXN11), transcript variant 3, 20 µg |
CNY 2900.00 |