E2F5 (NM_001951) Human Mass Spec Standard
CAT#: PH324285
E2F5 MS Standard C13 and N15-labeled recombinant protein (NP_001942)
View other "E2F5" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
| Product Data | |
| Description | E2F5 MS Standard C13 and N15-labeled recombinant protein (NP_001942) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224285 |
| Predicted MW | 37.4 kDa |
| Protein Sequence |
>RC224285 representing NM_001951
Red=Cloning site Green=Tags(s) MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTTKFVSLLQEAK DGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRYLKAEIEDL ELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICNCFNGDTLLAIQAPSGTQLEVPIPEMGQNGQ KKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSER SQALQQTSATDISSAGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001942 |
| RefSeq Size | 1752 |
| RefSeq ORF | 1038 |
| Synonyms | E2F-5 |
| Locus ID | 1875 |
| Cytogenetics | 8q21.2 |
| Summary | The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionarily conserved domains that are present in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It has higher identity to E2F4 than to other family members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB. Alternative splicing results in multiple variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Cell cycle, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419631 | E2F5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421221 | E2F5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419631 | Transient overexpression lysate of E2F transcription factor 5, p130-binding (E2F5), transcript variant 1 |
CNY 3080.00 |
|
| LY421221 | Transient overexpression lysate of E2F transcription factor 5, p130-binding (E2F5), transcript variant 2 |
CNY 3080.00 |
|
| TP324285 | Recombinant protein of human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760686 | Purified recombinant protein of Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
