PRMT1 (NM_001536) Human Mass Spec Standard
CAT#: PH324239
PRMT1 MS Standard C13 and N15-labeled recombinant protein (NP_001527)
View other "PRMT1" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PRMT1 MS Standard C13 and N15-labeled recombinant protein (NP_001527) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224239 |
Predicted MW | 42.3 kDa |
Protein Sequence |
>RC224239 representing NM_001536
Red=Cloning site Green=Tags(s) MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVT IIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDY VHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFT IDLDFKGQLCELSCSTDYRMR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001527 |
RefSeq Size | 1386 |
RefSeq ORF | 1113 |
Synonyms | ANM1; HCP1; HRMT1L2; IR1B4 |
Locus ID | 3276 |
Cytogenetics | 19q13.33 |
Summary | This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405016 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405017 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419868 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405016 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 3 |
CNY 3080.00 |
|
LY405017 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 2 |
CNY 3080.00 |
|
LY419868 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 1 |
CNY 3080.00 |
|
PH314074 | PRMT1 MS Standard C13 and N15-labeled recombinant protein (NP_938075) |
CNY 14250.00 |
|
TP314074 | Recombinant protein of human protein arginine methyltransferase 1 (PRMT1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP324239 | Recombinant protein of human protein arginine methyltransferase 1 (PRMT1), transcript variant 1, 20 µg |
CNY 2900.00 |