DIABLO (NM_138929) Human Mass Spec Standard
CAT#: PH324190
DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620307)
View other "DIABLO" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620307) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224190 |
| Predicted MW | 15.9 kDa |
| Protein Sequence |
>RC224190 representing NM_138929
Red=Cloning site Green=Tags(s) MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQAVYTLTSLY RQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITAR NHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620307 |
| RefSeq Size | 1366 |
| RefSeq ORF | 585 |
| Synonyms | DFNA64; DIABLO-S; SMAC; SMAC3 |
| Locus ID | 56616 |
| Cytogenetics | 12q24.31 |
| Summary | This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408473 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412673 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429603 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408473 | Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| LY412673 | Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| PH324145 | DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620308) |
CNY 14250.00 |
|
| TP324145 | Purified recombinant protein of Homo sapiens diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP324190 | Recombinant protein of human diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2900.00 |
