ACOT7 (NM_181866) Human Mass Spec Standard
CAT＃: PH324159
ACOT7 MS Standard C13 and N15-labeled recombinant protein (NP_863656)
View other "ACOT7" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | ACOT7 MS Standard C13 and N15-labeled recombinant protein (NP_863656) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224159 |
| Predicted MW | 36.4 kDa |
| Protein Sequence |
>RC224159 representing NM_181866
Red=Cloning site Green=Tags(s) MAFQLSRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGEV AHVSAEITYTSKHSVEVQVNVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVVYSRQEQEEEGR KRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIV AARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDSSQKRYRAASAFFT YVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHAEPQP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_863656 |
| RefSeq Size | 1376 |
| RefSeq ORF | 987 |
| Synonyms | ACH1; ACT; BACH; CTE-II; hBACH; LACH; LACH1 |
| Locus ID | 11332 |
| Cytogenetics | 1p36.31 |
| Summary | This gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester of palmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesial temporal lobe epilepsy. Alternatively spliced transcript variants encoding distinct isoforms with different subcellular locations have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Biosynthesis of unsaturated fatty acids |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405559 | ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405560 | ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405561 | ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405559 | Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHb |
CNY 3080.00 |
|
| LY405560 | Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHc |
CNY 3080.00 |
|
| LY405561 | Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHd |
CNY 3080.00 |
|
| TP324159 | Recombinant protein of human acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHd, 20 µg |
CNY 2900.00 |
