REG3A (NM_138938) Human Mass Spec Standard
CAT#: PH323860
REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620355)
View other "REG3A" proteins (14)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620355) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC223860 | 
| Predicted MW | 19.4 kDa | 
| Protein Sequence | 
                 >RC223860 protein sequence 
Red=Cloning site Green=Tags(s) MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQK RPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTI SSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_620355 | 
| RefSeq Size | 1117 | 
| RefSeq ORF | 525 | 
| Synonyms | HIP; HIP/PAP; INGAP; PAP; PAP-H; PAP1; PBCGF; REG-III; REG3 | 
| Locus ID | 5068 | 
| Cytogenetics | 2p12 | 
| Summary | This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Nov 2014] | 
| Protein Families | Druggable Genome, Secreted Protein | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400917 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC408477 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC408478 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC430071 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400917 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY408477 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 3 | 
                                                     CNY 3080.00  | 
                                            |
| LY408478 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY430071 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| PH307791 | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_002571) | 
                                                     CNY 19520.00  | 
                                            |
| PH316966 | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620354) | 
                                                     CNY 19520.00  | 
                                            |
| TP307791 | Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP316966 | Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 3, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP323860 | Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP701057 | Purified recombinant protein of Human regenerating islet-derived 3 alpha (REG3A), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug | 
                                                     CNY 7106.00  | 
                                            
