C7orf53 (LSMEM1) (NM_182597) Human Mass Spec Standard
CAT#: PH323802
C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_872403)
View other "C7orf53" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_872403) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223802 |
| Predicted MW | 14.3 kDa |
| Protein Sequence |
>RC223802 representing NM_182597
Red=Cloning site Green=Tags(s) MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIV LIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_872403 |
| RefSeq Size | 1691 |
| RefSeq ORF | 393 |
| Synonyms | C7orf53 |
| Locus ID | 286006 |
| Cytogenetics | 7q31.1 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403647 | LSMEM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427449 | LSMEM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403647 | Transient overexpression lysate of chromosome 7 open reading frame 53 (C7orf53), transcript variant 1 |
CNY 3080.00 |
|
| LY427449 | Transient overexpression lysate of chromosome 7 open reading frame 53 (C7orf53), transcript variant 2 |
CNY 3080.00 |
|
| PH325094 | C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_001127940) |
CNY 19520.00 |
|
| TP323802 | Recombinant protein of human chromosome 7 open reading frame 53 (C7orf53), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325094 | Recombinant protein of human chromosome 7 open reading frame 53 (C7orf53), transcript variant 2, 20 µg |
CNY 2900.00 |
其它C7orf53产品
