Casein (CSN1S1) (NM_001890) Human Mass Spec Standard
CAT#: PH323721
CSN1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001881)
View other "Casein" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | CSN1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001881) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223721 |
| Predicted MW | 21.7 kDa |
| Protein Sequence |
>RC223721 protein sequence
Red=Cloning site Green=Tags(s) MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNE STQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLN QLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001881 |
| RefSeq Size | 981 |
| RefSeq ORF | 555 |
| Synonyms | CASA; CSN1 |
| Locus ID | 1446 |
| Cytogenetics | 4q13.3 |
| Summary | Important role in the capacity of milk to transport calcium phosphate.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419687 | CSN1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422589 | CSN1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419687 | Transient overexpression lysate of casein alpha s1 (CSN1S1), transcript variant 1 |
CNY 3080.00 |
|
| LY422589 | Transient overexpression lysate of casein alpha s1 (CSN1S1), transcript variant 2 |
CNY 3080.00 |
|
| TP323721 | Recombinant protein of human casein alpha s1 (CSN1S1), transcript variant 1, 20 µg |
CNY 2900.00 |
