BMF (NM_033503) Human Mass Spec Standard
CAT#: PH323634
BMF MS Standard C13 and N15-labeled recombinant protein (NP_277038)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | BMF MS Standard C13 and N15-labeled recombinant protein (NP_277038) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223634 |
| Predicted MW | 20.3 kDa |
| Protein Sequence |
>RC223634 representing NM_033503
Red=Cloning site Green=Tags(s) MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT QTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCI ADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_277038 |
| RefSeq Size | 4551 |
| RefSeq ORF | 552 |
| Locus ID | 90427 |
| Cytogenetics | 15q15.1 |
| Summary | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424040 | BMF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424040 | Transient overexpression lysate of Bcl2 modifying factor (BMF), transcript variant 1 |
CNY 3080.00 |
|
| TP323634 | Recombinant protein of human Bcl2 modifying factor (BMF), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP760195 | Recombinant protein of human Bcl2 modifying factor (BMF), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
