SHTN1 (NM_018330) Human Mass Spec Standard
CAT#: PH323326
KIAA1598 MS Standard C13 and N15-labeled recombinant protein (NP_060800)
View other "SHTN1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | KIAA1598 MS Standard C13 and N15-labeled recombinant protein (NP_060800) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223326 |
Predicted MW | 52.5 kDa |
Protein Sequence |
>RC223326 representing NM_018330
Red=Cloning site Green=Tags(s) MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQ NHLEIEKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQC QKQIKELRDQIVSVQEEKKILAIELENLKSKLVEVIEEVNKVKQEKTVLNSEVLEQRKVLEKCNRVSMLA VEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEER IQHQQKVKELEEQLENETLHKEIHNLKQQLELLEEDKKELELKYQNSEEKARNLKHSVDELQKRVNQSEN SVPPPPPPPPPLPPPPPNPIRSLMSMIRKRSHPSGSGAKKEKATQPETTEEVTDLKRQAVEEMMDRIKKG VHLRPVNQTARPKTKPESSKGCESAVDELKGILASQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060800 |
RefSeq Size | 3415 |
RefSeq ORF | 1368 |
Synonyms | KIAA1598; shootin-1 |
Locus ID | 57698 |
Cytogenetics | 10q25.3 |
Summary | Involved in the generation of internal asymmetric signals required for neuronal polarization and neurite outgrowth. Mediates netrin-1-induced F-actin-substrate coupling or 'clutch engagement' within the axon growth cone through activation of CDC42, RAC1 and PAK1-dependent signaling pathway, thereby converting the F-actin retrograde flow into traction forces, concomitantly with filopodium extension and axon outgrowth. Plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone. Plays also a role in regenerative neurite outgrowth. In the developing cortex, cooperates with KIF20B to promote both the transition from the multipolar to the bipolar stage and the radial migration of cortical neurons from the ventricular zone toward the superficial layer of the neocortex. Involved in the accumulation of phosphatidylinositol 3,4,5-trisphosphate (PIP3) in the growth cone of primary hippocampal neurons.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413126 | KIAA1598 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC426712 | KIAA1598 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413126 | Transient overexpression lysate of KIAA1598 (KIAA1598), transcript variant 2 |
CNY 4840.00 |
|
LY426712 | Transient overexpression lysate of KIAA1598 (KIAA1598), transcript variant 1 |
CNY 3080.00 |
|
PH326044 | KIAA1598 MS Standard C13 and N15-labeled recombinant protein (NP_001120683) |
CNY 14250.00 |
|
TP323326 | Recombinant protein of human KIAA1598 (KIAA1598), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP326044 | Purified recombinant protein of Homo sapiens KIAA1598 (KIAA1598), transcript variant 1, 20 µg |
CNY 2900.00 |