C11orf17 (AKIP1) (NM_020642) Human Mass Spec Standard
CAT#: PH323315
C11orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065693)
View other "C11orf17" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | C11orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065693) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223315 |
Predicted MW | 22.9 kDa |
Protein Sequence |
>RC223315 representing NM_020642
Red=Cloning site Green=Tags(s) MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRV LPGEREERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDR KKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065693 |
RefSeq Size | 1332 |
RefSeq ORF | 630 |
Synonyms | BCA3; C11orf17 |
Locus ID | 56672 |
Cytogenetics | 11p15.4 |
Summary | This gene encodes a nuclear protein that interacts with protein kinase A catalytic subunit, and regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402797 | AKIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405392 | AKIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402797 | Transient overexpression lysate of chromosome 11 open reading frame 17 (C11orf17), transcript variant 1 |
CNY 3080.00 |
|
LY405392 | Transient overexpression lysate of chromosome 11 open reading frame 17 (C11orf17), transcript variant 1 |
CNY 3080.00 |
|
TP323315 | Recombinant protein of human chromosome 11 open reading frame 17 (C11orf17), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP760335 | Purified recombinant protein of Homo sapiens A kinase (PRKA) interacting protein 1 (AKIP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它C11orf17产品