Keratinocyte differentiation associated protein (KRTDAP) (NM_207392) Human Mass Spec Standard
CAT#: PH323306
KRTDAP MS Standard C13 and N15-labeled recombinant protein (NP_997275)
View other "Keratinocyte differentiation associated protein" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | KRTDAP MS Standard C13 and N15-labeled recombinant protein (NP_997275) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223306 |
Predicted MW | 11 kDa |
Protein Sequence |
>RC223306 protein sequence
Red=Cloning site Green=Tags(s) MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALF ESIKRKLPFLNWDAFPKLKGLRSATPDAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_997275 |
RefSeq Size | 500 |
RefSeq ORF | 297 |
Synonyms | KDAP; UNQ467 |
Locus ID | 388533 |
Cytogenetics | 19q13.12 |
Summary | This gene encodes a protein which may function in the regulation of keratinocyte differentiation and maintenance of stratified epithelia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404003 | KRTDAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404003 | Transient overexpression lysate of keratinocyte differentiation-associated protein (KRTDAP) |
CNY 3080.00 |
|
TP323306 | Recombinant protein of human keratinocyte differentiation-associated protein (KRTDAP), 20 µg |
CNY 2900.00 |
其它Keratinocyte differentiation associated protein产品