Keratinocyte differentiation associated protein (KRTDAP) (NM_207392) Human Mass Spec Standard
CAT#: PH323306
KRTDAP MS Standard C13 and N15-labeled recombinant protein (NP_997275)
View other "Keratinocyte differentiation associated protein" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | KRTDAP MS Standard C13 and N15-labeled recombinant protein (NP_997275) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223306 |
| Predicted MW | 11 kDa |
| Protein Sequence |
>RC223306 protein sequence
Red=Cloning site Green=Tags(s) MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALF ESIKRKLPFLNWDAFPKLKGLRSATPDAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_997275 |
| RefSeq Size | 500 |
| RefSeq ORF | 297 |
| Synonyms | KDAP; UNQ467 |
| Locus ID | 388533 |
| Cytogenetics | 19q13.12 |
| Summary | This gene encodes a protein which may function in the regulation of keratinocyte differentiation and maintenance of stratified epithelia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404003 | KRTDAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404003 | Transient overexpression lysate of keratinocyte differentiation-associated protein (KRTDAP) |
CNY 3080.00 |
|
| TP323306 | Recombinant protein of human keratinocyte differentiation-associated protein (KRTDAP), 20 µg |
CNY 2900.00 |
其它Keratinocyte differentiation associated protein产品
