Orosomucoid 2 (ORM2) (NM_000608) Human Mass Spec Standard
CAT#: PH323213
ORM2 MS Standard C13 and N15-labeled recombinant protein (NP_000599)
View other "Orosomucoid 2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ORM2 MS Standard C13 and N15-labeled recombinant protein (NP_000599) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223213 |
Predicted MW | 23.6 kDa |
Protein Sequence |
>RC223213 protein sequence
Red=Cloning site Green=Tags(s) MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT PNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNW GLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000599 |
RefSeq Size | 844 |
RefSeq ORF | 603 |
Synonyms | AGP-B; AGP-B'; AGP2 |
Locus ID | 5005 |
Cytogenetics | 9q32 |
Summary | This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424609 | ORM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424609 | Transient overexpression lysate of orosomucoid 2 (ORM2) |
CNY 3080.00 |
|
TP323213 | Recombinant protein of human orosomucoid 2 (ORM2), 20 µg |
CNY 2900.00 |
|
TP720822 | Purified recombinant protein of Human orosomucoid 2 (ORM2) |
CNY 1800.00 |
其它Orosomucoid 2产品