SCN3B (NM_001040151) Human Mass Spec Standard
CAT#: PH323114
SCN3B MS Standard C13 and N15-labeled recombinant protein (NP_001035241)
View other "SCN3B" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | SCN3B MS Standard C13 and N15-labeled recombinant protein (NP_001035241) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223114 |
| Predicted MW | 24.7 kDa |
| Protein Sequence |
>RC223114 protein sequence
Red=Cloning site Green=Tags(s) MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGK DFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRL IPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEEAAQENASDYLAIPSENKENSA VPVEE SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035241 |
| RefSeq Size | 5682 |
| RefSeq ORF | 645 |
| Synonyms | ATFB16; BRGDA7; HSA243396; SCNB3 |
| Locus ID | 55800 |
| Cytogenetics | 11q24.1 |
| Summary | Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel beta subunit gene family, and influences the inactivation kinetics of the sodium channel. Two alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Ion Channels: Sodium, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402676 | SCN3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421696 | SCN3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425685 | SCN3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402676 | Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1 |
CNY 3080.00 |
|
| LY421696 | Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2 |
CNY 3080.00 |
|
| LY425685 | Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2 |
CNY 3080.00 |
|
| TP323114 | Purified recombinant protein of Homo sapiens sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, 20 µg |
CNY 2900.00 |
