ANKFY1 (NM_020740) Human Mass Spec Standard
CAT#: PH323110
ANKFY1 MS Standard C13 and N15-labeled recombinant protein (NP_065791)
View other "ANKFY1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | ANKFY1 MS Standard C13 and N15-labeled recombinant protein (NP_065791) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223110 |
| Predicted MW | 54.6 kDa |
| Protein Sequence |
>RC223110 representing NM_020740
Red=Cloning site Green=Tags(s) MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVADLYEQEQYSDL KIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFREDDVFLTELMK LANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASHWDDLRKEDFSSMSAQLL YKMIKSKTEYPLHKAIKVEREDVVFLYLIEMDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVSHKA DVDMVDKSGWSLLHKGIQRGDLFAATFLIKNGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIA EALLQAGANPNMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSV NPFEDVPVVNGTSFDENSFAARLIQRGSHTDAPDTATGKARASRRGDAGVCRRQEMACKCLHPKFRN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065791 |
| RefSeq Size | 1904 |
| RefSeq ORF | 1461 |
| Synonyms | ANKHZN; DKFZp686M19106; KIAA1255; ZFYVE14 |
| Locus ID | 51479 |
| Cytogenetics | 17p13.2 |
| Summary | This gene encodes a cytoplasmic protein that contains a coiled-coil structure and a BTB/POZ domain at its N-terminus, ankyrin repeats in the middle portion, and a FYVE-finger motif at its C-terminus. This protein belongs to a subgroup of double zinc finger proteins which may be involved in vesicle or protein transport. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, Apr 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412365 | ANKFY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC413980 | ANKFY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY412365 | Transient overexpression lysate of ankyrin repeat and FYVE domain containing 1 (ANKFY1), transcript variant 2 |
CNY 4840.00 |
|
| LY413980 | Transient overexpression lysate of ankyrin repeat and FYVE domain containing 1 (ANKFY1), transcript variant 1 |
CNY 4840.00 |
|
| TP323110 | Recombinant protein of human ankyrin repeat and FYVE domain containing 1 (ANKFY1), transcript variant 2, 20 µg |
CNY 2900.00 |
