WTAP (NM_152857) Human Mass Spec Standard
CAT#: PH323046
WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596)
View other "WTAP" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223046 |
| Predicted MW | 17.6 kDa |
| Protein Sequence |
>RC223046 representing NM_152857
Red=Cloning site Green=Tags(s) MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN ELSAWKFTPDR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_690596 |
| RefSeq Size | 1644 |
| RefSeq ORF | 453 |
| Synonyms | Mum2 |
| Locus ID | 9589 |
| Cytogenetics | 6q25.3 |
| Summary | The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407186 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407187 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417661 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430230 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407186 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 |
CNY 3080.00 |
|
| LY407187 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
CNY 3080.00 |
|
| LY417661 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 1 |
CNY 3080.00 |
|
| LY430230 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
CNY 3080.00 |
|
| PH309632 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897) |
CNY 19520.00 |
|
| PH323099 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690597) |
CNY 19520.00 |
|
| TP309632 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP323046 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323099 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 3, 20 µg |
CNY 2900.00 |
