SKA3 (NM_145061) Human Mass Spec Standard
CAT#: PH322931
SKA3 MS Standard C13 and N15-labeled recombinant protein (NP_659498)
View other "SKA3" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SKA3 MS Standard C13 and N15-labeled recombinant protein (NP_659498) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222931 |
Predicted MW | 46.2 kDa |
Protein Sequence |
>RC222931 representing NM_145061
Red=Cloning site Green=Tags(s) MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNILLDKARLENQ EGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSDPELSNCENFQKTDVKDDLSD PPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVNNYKEEPVIVTPPTKQSLVKVLKTPKCALKM DDFECVTPKLEHFGISEYTMCLNEDYTMGLKNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEY TNSPLVPTFCTPGLKIPSTKNSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTIS SYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_659498 |
RefSeq Size | 2907 |
RefSeq ORF | 1236 |
Synonyms | C13orf3; RAMA1 |
Locus ID | 221150 |
Cytogenetics | 13q12.11 |
Summary | This gene encodes a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408058 | SKA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431342 | SKA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408058 | Transient overexpression lysate of spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 1 |
CNY 3080.00 |
|
LY431342 | Transient overexpression lysate of spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 2 |
CNY 3080.00 |
|
TP322931 | Recombinant protein of human chromosome 13 open reading frame 3 (C13orf3), 20 µg |
CNY 2900.00 |
|
TP328314 | Recombinant protein of human spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 2, 20 µg |
CNY 2900.00 |