Sprouty 1 (SPRY1) (NM_199327) Human Mass Spec Standard
CAT#: PH322860
SPRY1 MS Standard C13 and N15-labeled recombinant protein (NP_955359)
View other "Sprouty 1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | SPRY1 MS Standard C13 and N15-labeled recombinant protein (NP_955359) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222860 |
| Predicted MW | 35.1 kDa |
| Protein Sequence |
>RC222860 protein sequence
Red=Cloning site Green=Tags(s) MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSP PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLC SAESMVEYGTCMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCL KLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_955359 |
| RefSeq Size | 2380 |
| RefSeq ORF | 957 |
| Synonyms | hSPRY1 |
| Locus ID | 10252 |
| Cytogenetics | 4q28.1 |
| Summary | May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401771 | SPRY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404622 | SPRY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401771 | Transient overexpression lysate of sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 1 |
CNY 3080.00 |
|
| LY404622 | Transient overexpression lysate of sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 2 |
CNY 3080.00 |
|
| TP322860 | Purified recombinant protein of Homo sapiens sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Sprouty 1产品
