SGK196 (POMK) (NM_032237) Human Mass Spec Standard
CAT#: PH322797
SGK196 MS Standard C13 and N15-labeled recombinant protein (NP_115613)
View other "SGK196" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SGK196 MS Standard C13 and N15-labeled recombinant protein (NP_115613) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222797 |
Predicted MW | 40 kDa |
Protein Sequence |
>RC222797 protein sequence
Red=Cloning site Green=Tags(s) MEKQPQNSRRGLAPREVPPAVGLLLIMALMNTLLYLCLDHFFIAPRQSTVDPTHCPYGHFRIGQMKNCSP WLSCEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGLQMLKSLQGTHVVTLLGY CEDDNTMLTEYHPLGSLSNLEETLNLSKYQNVNTWQHRLELAMDYVSIINYLHHSPVGTRVMCDSNDLPK TLSQYLLTSNFSILANDLDALPLVNHSSGMLVKCGHRELHGDFVAPEQLWPYGEDVPFHDDLMPSYDEKI DIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115613 |
RefSeq Size | 1623 |
RefSeq ORF | 1050 |
Synonyms | MDDGA12; MDDGC12; SGK196 |
Locus ID | 84197 |
Cytogenetics | 8p11.21 |
Summary | This gene encodes a protein that may be involved in the presentation of the laminin-binding O-linked carbohydrate chain of alpha-dystroglycan (a-DG), which forms transmembrane linkages between the extracellular matrix and the exoskeleton. Some pathogens use this O-linked carbohydrate unit for host entry. Loss of function compound heterozygous mutations in this gene were found in a human patient affected by the Walker-Warburg syndrome (WWS) phenotype. Mice lacking this gene contain misplaced neurons (heterotopia) in some regions of the brain, possibly from defects in neuronal migration. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410261 | POMK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410261 | Transient overexpression lysate of protein kinase-like protein SgK196 (SGK196) |
CNY 3080.00 |
|
TP322797 | Recombinant protein of human protein kinase-like protein SgK196 (SGK196), 20 µg |
CNY 2900.00 |