TM4SF19 (NM_138461) Human Mass Spec Standard
CAT#: PH322675
TM4SF19 MS Standard C13 and N15-labeled recombinant protein (NP_612470)
View other "TM4SF19" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TM4SF19 MS Standard C13 and N15-labeled recombinant protein (NP_612470) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222675 |
| Predicted MW | 22.3 kDa |
| Protein Sequence |
>RC222675 representing NM_138461
Red=Cloning site Green=Tags(s) MVSSPCTPASSRTCSRILGLSLGTAALFAAGANVALLLPNWDVTYLLRGLLGRHAMLGTGLWGGGLMVLT AAILISLMGWRYGCFSKSGLCRSVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKY GYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSLFSALLCISLLQLLLVVVHVINSLLGLFCSLCEK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_612470 |
| RefSeq Size | 975 |
| RefSeq ORF | 627 |
| Synonyms | OCTM4 |
| Locus ID | 116211 |
| Cytogenetics | 3q29 |
| Summary | The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2017] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403356 | TM4SF19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403356 | Transient overexpression lysate of transmembrane 4 L six family member 19 (TM4SF19) |
CNY 3080.00 |
|
| TP322675 | Recombinant protein of human transmembrane 4 L six family member 19 (TM4SF19), 20 µg |
CNY 2900.00 |
其它TM4SF19产品
