FSH beta (FSHB) (NM_000510) Human Mass Spec Standard
CAT#: PH322666
FSHB MS Standard C13 and N15-labeled recombinant protein (NP_000501)
View other "FSH beta" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | FSHB MS Standard C13 and N15-labeled recombinant protein (NP_000501) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222666 |
Predicted MW | 14.7 kDa |
Protein Sequence |
>RC222666 protein sequence
Red=Cloning site Green=Tags(s) MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000501 |
RefSeq Size | 1936 |
RefSeq ORF | 387 |
Synonyms | HH24 |
Locus ID | 2488 |
Cytogenetics | 11p14.1 |
Summary | The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | GnRH signaling pathway, Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400397 | FSHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424668 | FSHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400397 | Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2 |
CNY 3080.00 |
|
LY424668 | Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 1 |
CNY 3080.00 |
|
PH314616 | FSHB MS Standard C13 and N15-labeled recombinant protein (NP_001018090) |
CNY 19520.00 |
|
TP314616 | Recombinant protein of human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP322666 | Recombinant protein of human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP701085 | Purified recombinant protein of Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, Asn19-end, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
其它FSH beta产品