CYP7B1 (NM_004820) Human Mass Spec Standard
CAT#: PH322647
CYP7B1 MS Standard C13 and N15-labeled recombinant protein (NP_004811)
View other "CYP7B1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 3340.00
Specifications
| Product Data | |
| Description | CYP7B1 MS Standard C13 and N15-labeled recombinant protein (NP_004811) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222647 |
| Predicted MW | 58.3 kDa |
| Protein Sequence |
>RC222647 representing NM_004820
Red=Cloning site Green=Tags(s) MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIKGWLPYLGVVLNLRKDPLRFM KTLQKQHGDTFTVLLGGKYITFILDPFQYQLVIKNHKQLSFRVFSNKLLEKAFSISQLQKNHDMNDELHL CYQFLQGKSLDILLESMMQNLKQVFEPQLLKTTSWDTAELYPFCSSIIFEITFTTIYGKVIVCDNNKFIS ELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDL EIGAHHLGFLWASVANTIPTMFWAMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLI CLESSIFEALRLSSYSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIE DGKKKTTFFKRGKKLKCYLMPFGTGTSKCPGRFFALMEIKQLLVILLTYFDLEIIDDKPIGLNYSRLLFG IQYPDSDVLFRYKVKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004811 |
| RefSeq Size | 2395 |
| RefSeq ORF | 1518 |
| Synonyms | CBAS3; CP7B; SPG5A |
| Locus ID | 9420 |
| Cytogenetics | 8q12.3 |
| Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. Mutations in this gene have been associated with hereditary spastic paraplegia (SPG5 or HSP), an autosomal recessive disorder. [provided by RefSeq, Apr 2016] |
| Protein Families | Druggable Genome, P450, Transmembrane |
| Protein Pathways | Primary bile acid biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417726 | CYP7B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY417726 | Transient overexpression lysate of cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1) |
CNY 4840.00 |
|
| TP322647 | Recombinant protein of human cytochrome P450, family 7, subfamily B, polypeptide 1 (CYP7B1), 20 µg |
CNY 2900.00 |
