GTSF1L (NM_001008901) Human Mass Spec Standard
CAT#: PH322477
GTSF1L MS Standard C13 and N15-labeled recombinant protein (NP_001008901)
View other "GTSF1L" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | GTSF1L MS Standard C13 and N15-labeled recombinant protein (NP_001008901) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222477 |
| Predicted MW | 14 kDa |
| Protein Sequence |
>RC222477 representing NM_001008901
Red=Cloning site Green=Tags(s) MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVE EEDTENPLKVSPPSSEQNDDTQQTFFPQKVVCENDTKESARETSPQKILRPGQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008901 |
| RefSeq Size | 773 |
| RefSeq ORF | 369 |
| Synonyms | C20orf65; dJ1028D15.4; FAM112A |
| Locus ID | 149699 |
| Cytogenetics | 20q13.12 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422897 | GTSF1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422897 | Transient overexpression lysate of gametocyte specific factor 1-like (GTSF1L), transcript variant 2 |
CNY 3080.00 |
|
| TP322477 | Recombinant protein of human gametocyte specific factor 1-like (GTSF1L), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP710312 | Purified recombinant protein of Human gametocyte specific factor 1-like (GTSF1L), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
