ANKRD16 (NM_001009942) Human Mass Spec Standard
CAT#: PH322437
ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942)
View other "ANKRD16" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222437 |
| Predicted MW | 35.3 kDa |
| Protein Sequence |
>RC222437 representing NM_001009942
Red=Cloning site Green=Tags(s) MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD YKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNS FHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALM DAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGHTSTIQTLLSLGADINSKDEKNRSALHLAC AGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAMT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001009942 |
| RefSeq Size | 1069 |
| RefSeq ORF | 978 |
| Synonyms | ankyrin repeat domain 16; OTTHUMP00000019019; OTTHUMP00000044872 |
| Locus ID | 54522 |
| Cytogenetics | 10p15.1 |
| Summary | Required to prevent the misactivation of serine (Ser) with tRNA(Ala) by promoting the hydrolysis of Ser-mischarged tRNA(Ala), thereby playing a role in translational fidelity. Binds directly to the catalytic domain of AARS/AlaRS and captures Ser that is misactivated by AARS/AlaRS, preventing the charging of Ser adenylates to tRNA(Ala) and precluding Ser misincorporation in nascent peptides.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412786 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423159 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423160 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423161 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412786 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 1 |
CNY 3080.00 |
|
| LY423159 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 2 |
CNY 3080.00 |
|
| LY423160 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 3 |
CNY 3080.00 |
|
| LY423161 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 4 |
CNY 3080.00 |
|
| PH309157 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_061919) |
CNY 14250.00 |
|
| PH315131 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009941) |
CNY 14250.00 |
|
| TP309157 | Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP315131 | Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP322437 | Purified recombinant protein of Homo sapiens ankyrin repeat domain 16 (ANKRD16), transcript variant 3, 20 µg |
CNY 2900.00 |
其它ANKRD16产品
