RUNX1T1 (NM_175635) Human Mass Spec Standard
CAT＃: PH322426
RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783553)
View other "RUNX1T1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783553) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222426 |
| Predicted MW | 63 kDa |
| Protein Sequence |
>RC222426 representing NM_175635
Red=Cloning site Green=Tags(s) MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSS SLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPL RPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDR TKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRH PSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE ELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVK RQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCS GCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPS TIETTPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_783553 |
| RefSeq Size | 3233 |
| RefSeq ORF | 1701 |
| Synonyms | AML1-MTG8; AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2 |
| Locus ID | 862 |
| Cytogenetics | 8q21.3 |
| Summary | This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010] |
| Protein Families | Transcription Factors |
| Protein Pathways | Acute myeloid leukemia, Pathways in cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403575 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406255 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406277 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC430432 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403575 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 3 |
CNY 3080.00 |
|
| LY406255 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4 |
CNY 3080.00 |
|
| LY406277 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 2 |
CNY 4840.00 |
|
| LY430432 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 2 |
CNY 3080.00 |
|
| PH300898 | RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783554) |
CNY 19520.00 |
|
| TP300898 | Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP322426 | Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它RUNX1T1产品
