DGKA (NM_001345) Human Mass Spec Standard
CAT#: PH322395
DGKA MS Standard C13 and N15-labeled recombinant protein (NP_001336)
View other "DGKA" proteins (17)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_001336) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222395 |
| Predicted MW | 82.5 kDa |
| Protein Sequence |
>RC222395 representing NM_001345
Red=Cloning site Green=Tags(s) MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001336 |
| RefSeq Size | 2756 |
| RefSeq ORF | 2205 |
| Synonyms | DAGK; DAGK1; DGK-alpha |
| Locus ID | 1606 |
| Cytogenetics | 12q13.2 |
| Summary | The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Apr 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400535 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404426 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404427 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC404458 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430856 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400535 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3 |
CNY 3080.00 |
|
| LY404426 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 |
CNY 3080.00 |
|
| LY404427 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2 |
CNY 4840.00 |
|
| LY404458 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4 |
CNY 3080.00 |
|
| LY430856 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 |
CNY 4840.00 |
|
| PH302930 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958852) |
CNY 19520.00 |
|
| PH318968 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958853) |
CNY 19520.00 |
|
| PH320293 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_963848) |
CNY 19520.00 |
|
| TP302930 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP318968 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP320293 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP322395 | Purified recombinant protein of Homo sapiens diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3, 20 µg |
CNY 2900.00 |
