CDK10 (NM_052988) Human Mass Spec Standard
CAT#: PH322310
CDK10 MS Standard C13 and N15-labeled recombinant protein (NP_443714)
View other "CDK10" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CDK10 MS Standard C13 and N15-labeled recombinant protein (NP_443714) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222310 |
| Predicted MW | 40.9 kDa |
| Protein Sequence |
>RC222310 representing NM_052988
Red=Cloning site Green=Tags(s) MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKV RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQV KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELL LGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQ PYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPAT SEGQSKRCKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_443714 |
| RefSeq Size | 1803 |
| RefSeq ORF | 1080 |
| Synonyms | ALSAS; PISSLRE |
| Locus ID | 8558 |
| Cytogenetics | 16q24.3 |
| Summary | The protein encoded by this gene belongs to the CDK subfamily of the Ser/Thr protein kinase family. The CDK subfamily members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and are known to be essential for cell cycle progression. This kinase has been shown to play a role in cellular proliferation and its function is limited to cell cycle G2-M phase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409344 | CDK10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409345 | CDK10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409344 | Transient overexpression lysate of cyclin-dependent kinase 10 (CDK10), transcript variant b |
CNY 3080.00 |
|
| LY409345 | Transient overexpression lysate of cyclin-dependent kinase 10 (CDK10), transcript variant a |
CNY 3080.00 |
|
| TP322310 | Recombinant protein of human cyclin-dependent kinase 10 (CDK10), transcript variant a, 20 µg |
CNY 2900.00 |
