plasticity related gene 3 (PLPPR1) (NM_207299) Human Mass Spec Standard
CAT#: PH322205
LPPR1 MS Standard C13 and N15-labeled recombinant protein (NP_997182)
View other "plasticity related gene 3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | LPPR1 MS Standard C13 and N15-labeled recombinant protein (NP_997182) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222205 |
| Predicted MW | 35.8 kDa |
| Protein Sequence |
>RC222205 protein sequence
Red=Cloning site Green=Tags(s) MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP LVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDI FVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALY ATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK GTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_997182 |
| RefSeq Size | 2461 |
| RefSeq ORF | 975 |
| Synonyms | LPPR1; PRG-3 |
| Locus ID | 54886 |
| Cytogenetics | 9q31.1 |
| Summary | This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008] |
| Protein Families | Phosphatase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404081 | LPPR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413579 | LPPR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404081 | Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1 |
CNY 3080.00 |
|
| LY413579 | Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 2 |
CNY 3080.00 |
|
| TP322205 | Recombinant protein of human plasticity related gene 3 (PRG-3), transcript variant 1, 20 µg |
CNY 2900.00 |
其它plasticity related gene 3产品
