Muted (BLOC1S5) (NM_201280) Human Mass Spec Standard
CAT#: PH321922
MUTED MS Standard C13 and N15-labeled recombinant protein (NP_958437)
View other "Muted" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MUTED MS Standard C13 and N15-labeled recombinant protein (NP_958437) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221922 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC221922 protein sequence
Red=Cloning site Green=Tags(s) MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGL REMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQ HMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_958437 |
RefSeq Size | 2695 |
RefSeq ORF | 561 |
Synonyms | BLOS5; HPS11; MU; MUTED |
Locus ID | 63915 |
Cytogenetics | 6p24.3 |
Summary | This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Alternative splicing results in multiple transcript variants. Read-through transcription exists between this gene and the upstream EEF1E1 (eukaryotic translation elongation factor 1 epsilon 1) gene, as well as with the downstream TXNDC5 (thioredoxin domain containing 5) gene. [provided by RefSeq, Dec 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404512 | BLOC1S5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404512 | Transient overexpression lysate of muted homolog (mouse) (MUTED) |
CNY 3080.00 |
|
TP321922 | Recombinant protein of human muted homolog (mouse) (MUTED), 20 µg |
CNY 2900.00 |