RND2 (NM_005440) Human Mass Spec Standard
CAT#: PH321840
RND2 MS Standard C13 and N15-labeled recombinant protein (NP_005431)
View other "RND2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RND2 MS Standard C13 and N15-labeled recombinant protein (NP_005431) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221840 |
Predicted MW | 25.4 kDa |
Protein Sequence |
>RC221840 protein sequence
Red=Cloning site Green=Tags(s) MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDN VRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIP VTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDR GNEGEIHKDRAKSCNLM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005431 |
RefSeq Size | 4169 |
RefSeq ORF | 681 |
Synonyms | ARHN; RHO7; RhoN |
Locus ID | 8153 |
Cytogenetics | 17q21.31 |
Summary | This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neuronal morphology and endosomal trafficking. The gene localizes to chromosome 17 and is the centromeric neighbor of the breast-ovarian cancer susceptibility gene BRCA1. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417303 | RND2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417303 | Transient overexpression lysate of Rho family GTPase 2 (RND2) |
CNY 3080.00 |
|
TP321840 | Recombinant protein of human Rho family GTPase 2 (RND2), 20 µg |
CNY 2900.00 |