ART5 (NM_001079536) Human Mass Spec Standard
CAT#: PH321774
ART5 MS Standard C13 and N15-labeled recombinant protein (NP_001073004)
View other "ART5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ART5 MS Standard C13 and N15-labeled recombinant protein (NP_001073004) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221774 |
| Predicted MW | 32.2 kDa |
| Protein Sequence |
>RC221774 protein sequence
Red=Cloning site Green=Tags(s) MALAALMIALGSLGLHTWQAQAVPTILPLGLAPDTFDDTYVGCVEEMEEKAAPLLKEEMAHHALLRESWE AAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIR ALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAP IQAFSVFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTG DLHMTKRHLQQP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001073004 |
| RefSeq Size | 1249 |
| RefSeq ORF | 876 |
| Synonyms | ARTC5 |
| Locus ID | 116969 |
| Cytogenetics | 11p15.4 |
| Summary | The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Several transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421524 | ART5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421524 | Transient overexpression lysate of ADP-ribosyltransferase 5 (ART5), transcript variant 2 |
CNY 3080.00 |
|
| TP321774 | Recombinant protein of human ADP-ribosyltransferase 5 (ART5), transcript variant 2, 20 µg |
CNY 2900.00 |
