VMO1 (NM_182566) Human Mass Spec Standard
CAT#: PH321753
VMO1 MS Standard C13 and N15-labeled recombinant protein (NP_872372)
View other "VMO1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
| Product Data | |
| Description | VMO1 MS Standard C13 and N15-labeled recombinant protein (NP_872372) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221753 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC221753 protein sequence
Red=Cloning site Green=Tags(s) MERGAGAKLLPLLLLLRATGFTCAQTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQ GIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAAN NVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_872372 |
| RefSeq Size | 785 |
| RefSeq ORF | 606 |
| Synonyms | ERGA6350; PRO21055 |
| Locus ID | 284013 |
| Cytogenetics | 17p13.2 |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405488 | VMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405488 | Transient overexpression lysate of vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 1 |
CNY 3080.00 |
|
| TP321753 | Purified recombinant protein of Homo sapiens vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720495 | Recombinant protein of human vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 3 |
CNY 1800.00 |
