SPRR2E (NM_001024209) Human Mass Spec Standard
CAT#: PH321721
SPRR2E MS Standard C13 and N15-labeled recombinant protein (NP_001019380)
View other "SPRR2E" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SPRR2E MS Standard C13 and N15-labeled recombinant protein (NP_001019380) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221721 |
Predicted MW | 7.7 kDa |
Protein Sequence |
>RC221721 representing NM_001024209
Red=Cloning site Green=Tags(s) MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPK SK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001019380 |
RefSeq Size | 762 |
RefSeq ORF | 216 |
Locus ID | 6704 |
Cytogenetics | 1q21.3 |
Summary | This gene encodes a member of a family of small proline-rich proteins clustered in the epidermal differentiation complex on chromosome 1q21. The encoded protein, along with other family members, is a component of the cornified cell envelope that forms beneath the plasma membrane in terminally differentiated stratified squamous epithelia. This envelope serves as a barrier against extracellular and environmental factors. The seven SPRR2 genes (A-G) appear to have been homogenized by gene conversion compared to others in the cluster that exhibit greater differences in protein structure. [provided by RefSeq, Feb 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422617 | SPRR2E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422617 | Transient overexpression lysate of small proline-rich protein 2E (SPRR2E) |
CNY 3080.00 |
|
TP321721 | Recombinant protein of human small proline-rich protein 2E (SPRR2E), 20 µg |
CNY 2900.00 |