CRAT (NM_004003) Human Mass Spec Standard
CAT#: PH321625
CRAT MS Standard C13 and N15-labeled recombinant protein (NP_003994)
View other "CRAT" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CRAT MS Standard C13 and N15-labeled recombinant protein (NP_003994) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221625 |
| Predicted MW | 68.4 kDa |
| Protein Sequence |
>RC221625 representing NM_004003
Red=Cloning site Green=Tags(s) MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRA RKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVE YLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFV QLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYR SHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSP MVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAY YRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAI RGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPM EAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQSHPRAKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003994 |
| RefSeq Size | 2600 |
| RefSeq ORF | 1815 |
| Synonyms | CAT; CAT1; NBIA8 |
| Locus ID | 1384 |
| Cytogenetics | 9q34.11 |
| Summary | This gene encodes carnitine O-acetyltransferase, a member of the carnitine acyltransferase family and a key metabolic pathway enzyme which plays an important role in energy homeostasis and fat metabolism. This enzyme catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acyl-CoA/CoA. It is found in both the mitochondria and the peroxisome. Alternative splicing results in transcript variants encoding different isoforms that may localize to different subcellular compartments. [provided by RefSeq, Oct 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400255 | CRAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC418259 | CRAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400255 | Transient overexpression lysate of carnitine acetyltransferase (CRAT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 4840.00 |
|
| LY418259 | Transient overexpression lysate of carnitine acetyltransferase (CRAT), transcript variant 2 |
CNY 4840.00 |
|
| TP321625 | Recombinant protein of human carnitine acetyltransferase (CRAT), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP760585 | Purified recombinant protein of Human carnitine O-acetyltransferase (CRAT), nuclear gene encoding mitochondrial protein, transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
