alpha Synuclein (SNCA) (NM_007308) Human Mass Spec Standard
CAT#: PH321446
SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292)
View other "alpha Synuclein" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221446 |
| Predicted MW | 11.2 kDa |
| Protein Sequence |
>RC221446 representing NM_007308
Red=Cloning site Green=Tags(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009292 |
| RefSeq Size | 1096 |
| RefSeq ORF | 336 |
| Synonyms | NACP; PARK1; PARK4; PD1 |
| Locus ID | 6622 |
| Cytogenetics | 4q22.1 |
| Summary | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400127 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416080 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431763 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431764 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400127 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 3080.00 |
|
| LY416080 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
CNY 3080.00 |
|
| LY431763 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 |
CNY 3080.00 |
|
| LY431764 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 |
CNY 3080.00 |
|
| PH310606 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) |
CNY 19520.00 |
|
| TP310606 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140, 20 µg |
CNY 2900.00 |
|
| TP321446 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112, 20 µg |
CNY 2900.00 |
|
| TP328735 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP328736 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720923 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 3140.00 |
|
| TP721177 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 1800.00 |
|
| TP750040 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug |
CNY 4020.00 |
其它alpha Synuclein产品
