EOLA1 (NM_178124) Human Mass Spec Standard
CAT#: PH321372
CXorf40A MS Standard C13 and N15-labeled recombinant protein (NP_835225)
View other "EOLA1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | CXorf40A MS Standard C13 and N15-labeled recombinant protein (NP_835225) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221372 |
Predicted MW | 17.9 kDa |
Protein Sequence |
>RC221372 protein sequence
Red=Cloning site Green=Tags(s) MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQA LLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGK DVFQVDIPEHLIPLGHEV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_835225 |
RefSeq Size | 2436 |
RefSeq ORF | 474 |
Synonyms | CXorf40; CXorf40A |
Locus ID | 91966 |
Cytogenetics | Xq28 |
Summary | May have an important role of cell protection in inflammation reaction.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
EOLA1 protects lipopolysaccharide induced IL-6 production and apoptosis by regulation of MT2A in human umbilical vein endothelial cells
,null,
Molecular and Cellular Biochemistry
,PubMed ID 24916366
[EOLA1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406036 | CXorf40A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432583 | CXorf40A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406036 | Transient overexpression lysate of chromosome X open reading frame 40A (CXorf40A), transcript variant 1 |
CNY 3080.00 |
|
LY432583 | Transient overexpression lysate of chromosome X open reading frame 40A (CXorf40A), transcript variant 4 |
CNY 3080.00 |
|
TP321372 | Recombinant protein of human chromosome X open reading frame 40A (CXorf40A), 20 µg |
CNY 2900.00 |