BCL2L12 (NM_138639) Human Mass Spec Standard
CAT#: PH321347
BCL2L12 MS Standard C13 and N15-labeled recombinant protein (NP_619580)
View other "BCL2L12" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | BCL2L12 MS Standard C13 and N15-labeled recombinant protein (NP_619580) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221347 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC221347 representing NM_138639
Red=Cloning site Green=Tags(s) MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQV EWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPC SLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAIL RRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARL ALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_619580 |
RefSeq Size | 1893 |
RefSeq ORF | 1002 |
Locus ID | 83596 |
Cytogenetics | 19q13.33 |
Summary | This gene encodes a member of a family of proteins containing a Bcl-2 homology domain 2 (BH2). The encoded protein is an anti-apoptotic factor that acts as an inhibitor of caspases 3 and 7 in the cytoplasm. In the nucleus, it binds to the p53 tumor suppressor protein, preventing its association with target genes. Overexpression of this gene has been detected in a number of different cancers. There is a pseudogene for this gene on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403365 | BCL2L12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420742 | BCL2L12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403365 | Transient overexpression lysate of BCL2-like 12 (proline rich) (BCL2L12), transcript variant 1 |
CNY 3080.00 |
|
LY420742 | Transient overexpression lysate of BCL2-like 12 (proline rich) (BCL2L12), transcript variant 3 |
CNY 3080.00 |
|
TP321347 | Recombinant protein of human BCL2-like 12 (proline rich) (BCL2L12), transcript variant 1, 20 µg |
CNY 2900.00 |
其它BCL2L12产品