alpha Lactalbumin (LALBA) (NM_002289) Human Mass Spec Standard
CAT#: PH321214
LALBA MS Standard C13 and N15-labeled recombinant protein (NP_002280)
View other "alpha Lactalbumin" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LALBA MS Standard C13 and N15-labeled recombinant protein (NP_002280) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221214 |
Predicted MW | 16.22 kDa |
Protein Sequence |
>RC221214 representing NM_002289
Red=Cloning site Green=Tags(s) MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYG LFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCE KL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002280 |
RefSeq Size | 742 |
RefSeq ORF | 426 |
Synonyms | LYZG |
Locus ID | 3906 |
Cytogenetics | 12q13.11 |
Summary | This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | Galactose metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400829 | LALBA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400829 | Transient overexpression lysate of lactalbumin, alpha- (LALBA) |
CNY 3080.00 |
|
TP321214 | Recombinant protein of human lactalbumin, alpha- (LALBA), 20 µg |
CNY 2900.00 |
其它alpha Lactalbumin产品