CNN2 (NM_004368) Human Mass Spec Standard
CAT#: PH321104
CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_004359)
View other "CNN2" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_004359) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC221104 | 
| Predicted MW | 33.5 kDa | 
| Protein Sequence | 
                 >RC221104 representing NM_004368 
Red=Cloning site Green=Tags(s) MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA DGAPSGTGDCPDPGEVPEYPPYYQEEAGY myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_004359 | 
| RefSeq Size | 2478 | 
| RefSeq ORF | 927 | 
| Locus ID | 1265 | 
| Cytogenetics | 19p13.3 | 
| Summary | The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC404509 | CNN2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC418024 | CNN2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY404509 | Transient overexpression lysate of calponin 2 (CNN2), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY418024 | Transient overexpression lysate of calponin 2 (CNN2), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| PH312208 | CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_958434) | 
                                                     CNY 14250.00  | 
                                            |
| TP312208 | Purified recombinant protein of Homo sapiens calponin 2 (CNN2), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP321104 | Recombinant protein of human calponin 2 (CNN2), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
