Interferon alpha 2 (IFNA2) (NM_000605) Human Mass Spec Standard
CAT#: PH321091
IFNA2 MS Standard C13 and N15-labeled recombinant protein (NP_000596)
View other "Interferon alpha 2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | IFNA2 MS Standard C13 and N15-labeled recombinant protein (NP_000596) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221091 |
Predicted MW | 21.4 kDa |
Protein Sequence |
>RC221091 representing NM_000605
Red=Cloning site Green=Tags(s) MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSIL AVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000596 |
RefSeq Size | 1142 |
RefSeq ORF | 564 |
Synonyms | IFN-alpha-2; IFN-alphaA; IFNA; IFNA2B; leIF A |
Locus ID | 3440 |
Cytogenetics | 9p21.3 |
Summary | This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. The encoded protein is effective in reducing the symptoms and duration of the common cold and in treating many types of cancer, including some hematological malignancies and solid tumors. A deficiency of type I interferon in the blood is thought to be a hallmark of severe COVID-19 and may provide a rationale for a combined therapeutic approach. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400201 | IFNA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400201 | Transient overexpression lysate of interferon, alpha 2 (IFNA2) |
CNY 3080.00 |
|
TP321091 | Recombinant protein of human interferon, alpha 2 (IFNA2), 20 µg |
CNY 2900.00 |
|
TP720005 | Recombinant protein of human interferon, alpha 2 (IFNA2) |
CNY 1800.00 |
|
TP720019 | Recombinant protein of human interferon, alpha 2 (IFNA2) |
CNY 1800.00 |
|
TP723881 | Purified recombinant protein of Human interferon, alpha 2 (IFNA2) |
CNY 4090.00 |
其它Interferon alpha 2产品