DEFB108B (NM_001002035) Human Mass Spec Standard
CAT#: PH321032
DEFB108B MS Standard C13 and N15-labeled recombinant protein (NP_001002035)
View other "DEFB108B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DEFB108B MS Standard C13 and N15-labeled recombinant protein (NP_001002035) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221032 |
| Predicted MW | 8.1 kDa |
| Protein Sequence |
>RC221032 representing NM_001002035
Red=Cloning site Green=Tags(s) MRIAVLLFAIFFFMSQVLPARGKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP KKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001002035 |
| RefSeq Size | 222 |
| RefSeq ORF | 219 |
| Synonyms | DEFB-8; hBD-8 |
| Locus ID | 245911 |
| Cytogenetics | 11q13.4 |
| Summary | Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. A pseudogene of this gene has been found on chromosome 8. [provided by RefSeq, Oct 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424174 | DEFB108B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424174 | Transient overexpression lysate of defensin, beta 108B (DEFB108B) |
CNY 3080.00 |
|
| TP321032 | Recombinant protein of human defensin, beta 108B (DEFB108B), 20 µg |
CNY 2900.00 |
其它DEFB108B产品
